Example of valid sequence and PDBID inputs:

>PDBID
3ygsC
>Q6Q899|DDX58_MOUSE| 1-91
MTAAQRQNLQAFRDYIKKILDPTYILSYMSSWLEDEEVQYIQAEKNNKGPMEAASLFLQY
LLKLQSEGWFQAFLDALYHAGYCGLCEAIES
>Q6Q899|DDX58_MOUSE| 101-176
EEHRLLLRRLEPEFKATVDPNDILSELSECLINQECEEIRQIRDTKGRMAGAEKMAECLI
RSDKENWPKVLQLALE
>PDBID
2p1hA
This is MAFFTash version 4.1.
If you experience problems, please use the Contact Us link at the top of the page.
MAFFTash utilizes the DASH structural domain database
Need help picking PDBIDs?
Use